DPCstruct | MC49689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 9.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 68.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6R989 | 114-231 | DLLTCRLCHDRKEDLIHLILCTKCHTGIHQILQTYQNHLFSKLREAEKLADMDPTPMLRKLSSLSCWTISSSNWSSYALIQGCLPKA… |
| A0A2H5S521 | 4-115 | LTCRSCIDRMEDLMHLFMCKNRHLPMQQILQSYQNHLLSKLLEAGNMADIDPTPLIAKLTSLSCWSFSSTNWSSYALVRGCLPKLFI… |
| A0A2I1EZA7 | 1-94 | None |
| A0A2Z6R5D5 | 2-98 | None |
| A0A2Z6R7J1 | 4-94 | None |
| A0A2Z6R936 | 242-347 | None |
| A0A2Z6RN71 | 257-375 | None |
| A0A2Z6RUU1 | 984-1089 | None |
| A0A2Z6RWT8 | 2-99 | None |
| A0A2H5RZG1 | 353-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.