DPCstruct | MC49687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 317 ± 26 aa |
| Standard deviation of domain lengths | 26.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 47.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5SQ92 | 167-475 | DNMEDRLEGLLDDAHNREEYLRQKLNNTRATILRTRRTYEDAYANEVRHRQHWEALTQNTQIQLANIQAQFANSQIQLANVQRERDE… |
| A0A2H5S0X3 | 61-372 | HALNLLIHRCRETYEERDILKAKRDRSRKERDDLQDELEVQTGLLGLTQDELNNVQDTITSLEANLAELEREFGGMRTTNRRLQQQY… |
| A0A2N1NJP7 | 1-371 | None |
| A0A2H5S2U9 | 1-295 | None |
| A0A2H5SZ41 | 297-627 | None |
| A0A2N1MF35 | 1-279 | None |
| A0A2N1M7V5 | 135-487 | None |
| A0A2N1M7S4 | 4-298 | None |
| A0A2H5U7N3 | 130-444 | None |
| A0A2Z6Q5P6 | 1-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.