DPCstruct | MC49671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 7.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8LVV2 | 339-419 | VFAVVCDGVTVGRSCCGVPHCDGQLLSTRDAFCKEHQDKKLICRVTGCTRPIESKNSKACDLSEHQALENQYHETERATFQ |
| E2LR93 | 14-91 | ALRAIVTDGITVGHPCCKVHNCTEPLVNNRAHFCQVHQDLKKLCVVNGCDRDARMGGKTCDEPAHVKLDEYKNLKGKG |
| A0A0D0AK63 | 20-99 | None |
| A0A4Y9YKR7 | 109-205 | None |
| A0A409YTS9 | 87-180 | None |
| A0A409YPC5 | 269-361 | None |
| S8DK14 | 160-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.