DPCstruct | MC49663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 123 ± 23 aa |
| Standard deviation of domain lengths | 23.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2EPK3 | 274-417 | RLIWLEMGVPPARLLPFGLKENFWEMGDSGPCGPCTEIHYDHVGGRDAGALVNADSPEVVEIWNLVHTLTGPGSHLLVVPGRSKGVA… |
| A0A1F6WC03 | 84-234 | LGHFSLYEGKEQEVKDVMIESAWHYLTVCAGISPATLSATVHPQDATSQKIWERLGVRTVSNDKNVTFTPTQNRCGIRTEIVWRNPD… |
| A0A5A9NS70 | 34-168 | None |
| A0A5B8MMV0 | 407-525 | None |
| A0A2G3BE36 | 34-145 | None |
| A0A1E1VX76 | 3-115 | None |
| A0A380QCL3 | 1-95 | None |
| A0A7V5LED0 | 118-236 | None |
| A0A0G1QQQ3 | 141-270 | None |
| A0A835RAS9 | 217-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.