DPCstruct | MC4966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 9.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848UST8 | 1-89 | MAQVSQITLDNVTFAQFRSDLNNSLNALNTGHLGSSRPSSAVAGTIWLDNSATNTIAMKLFDGTDDLELFSINTSTNAITLPSGVSI… |
| A0A178MWQ9 | 3-85 | QVDEFAINGVSPLSMATLEARLDALFGAAVSYNRGTTAPSNPFEGMLWWDSSAAPDVLKRYTVAAGWISILTINITTGAIAFA |
| F7X1Z2 | 1-75 | None |
| A0A7W4VNV6 | 1-91 | None |
| A0A1Q6TYB8 | 1-80 | None |
| A0A292QX46 | 1-80 | None |
| A0A081NL41 | 1-76 | None |
| A0A506TZD9 | 1-105 | None |
| A0A0F9P895 | 1-91 | None |
| A0A6S5U2T7 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.