DPCstruct | MC49658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 60 ± 7 aa |
| Standard deviation of domain lengths | 7.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 78.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01803 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2EFT0 | 1-80 | MSIGRTLIPRYFSTVFEGGVTELHYILKHSKESFHNSCITLDCDQCTMVTQHGKPMFTKVTPAPPTHTPHPPHPSELLPP |
| A0A672R907 | 21-75 | IGRTLIPRYFRSIFEGGATELFYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF |
| A0A498MYM1 | 15-77 | None |
| A0A498MS93 | 116-170 | None |
| A0A2C9JTF2 | 151-205 | None |
| A0A643BXR3 | 83-142 | None |
| A0A7R9BKX6 | 381-445 | None |
| A0A0P7UUJ0 | 17-71 | None |
| A0A6J3KJH2 | 365-419 | None |
| A0A498M0F9 | 120-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.