DPCstruct | MC49657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 155 ± 15 aa |
| Standard deviation of domain lengths | 15.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.83 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0167- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2EFE9 | 3-131 | IRQARSYILRCHACFRTTSIMTKAFCPHCGNATLKKLAVTLGEDGSTQVHFSRNPKVLNPRGLRRAPQQRLSRKARQQTDALDPDYA… |
| A0A091CRN5 | 254-407 | MLIREARSSILRCHGCFKTTSDMSRVFCAHCGNKTLKKVAVTVSEDGTLHMLFSRNPKVLNPRGLRYPLPMPKGGKYASNPHLTEDQ… |
| A0A6D2L598 | 327-509 | None |
| A0A2G3AP77 | 676-839 | None |
| F4PYZ1 | 789-952 | None |
| A0A7S3G7P3 | 416-572 | None |
| A0A2R6X669 | 355-524 | None |
| A0A7J6PJ45 | 581-760 | None |
| A0A818SHL0 | 286-423 | None |
| K1PYC8 | 39-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.