DPCstruct | MC49642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0408 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2E2I5 | 34-129 | AGQARLDGAFCAYTEKDKQDYLNKACEAGICNIEMESSVFAAMCRLSGLRAAVVCVTLLDRLNGDQLDTSQDVLHSYQQRPQILVGY… |
| A0A1U8CXV7 | 106-199 | EGQGRLDGALCSFSSEKKLEYLKRAYNAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLNRLEGDQITVPHEVLLEYQRRPQQLISI… |
| A0A2A6BA99 | 131-229 | None |
| A0A2P4XKK5 | 211-304 | None |
| A0A183F8M5 | 2-91 | None |
| A0A3P6I910 | 1-100 | None |
| A0A1V9ZXS8 | 866-956 | None |
| M7CD98 | 65-154 | None |
| A0A662WPF0 | 574-675 | None |
| T1KTE8 | 266-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.