DPCstruct | MC49641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 8.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17226 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2E0Z9 | 1-100 | MRHGGSPKFAVKTRQAFFLQTTGLTMMARRLCYDIIRPRFLARHPYLPLNTAAIKAECALRSPEVPKKPSPLKPAERKPLESVVRYL… |
| A0A401RZD1 | 217-305 | HIDSPKSTLKTRQSFFLQTTRLTKLARHVCRDILQLKQAARKPFVPINCAAIKAECAMRFPEAVKRPLSIKVTLRKPLTSIIKYLEA… |
| A0A402F114 | 113-214 | None |
| A0A3Q2SNU6 | 525-627 | None |
| A0A3P8V9F0 | 384-465 | None |
| A0A060Z8D2 | 91-186 | None |
| A0A091CW01 | 816-918 | None |
| A0A060XMC8 | 331-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.