DPCstruct | MC4964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 8.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5HPY6 | 11-106 | AALDTYEPVPGNIDLTARPQVVNPDGSVSTVRSMSFNEGGREVLVPTVSDDGRIMDNDEAIAQYLKSGRHLGIFRTPEEATAYAKRL… |
| A0A5B8LI06 | 454-558 | YEGPDPAAANDGAPVTPVTPGNIDLNTRPVVRNKDGSISTVRSMSFGTPQGEVLVPTVSDDGRIMSDREAIDNYYRTGRMLGVFRTP… |
| X6JE31 | 273-373 | None |
| A0A220W6M2 | 1-101 | None |
| A0A437LZC2 | 211-305 | None |
| A0A2N2HV91 | 208-332 | None |
| A0A7S9GW53 | 37-143 | None |
| R6J8Y3 | 78-186 | None |
| A0A2G0W9G2 | 701-816 | None |
| A0A6M3ILB2 | 591-695 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.