DPCstruct | MC49638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 107 ± 6 aa |
| Standard deviation of domain lengths | 5.74 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2DZX4 | 1-112 | MSVVITPGVGVFQVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRTTPGDSRVGDDYNLPHWINHSFYTSKSQNSCSS… |
| Q4DPH5 | 634-737 | LVLEECIQSRWDTNTGYIISIVTAGKGLYQVTNELSQTTCTRLFSIGIEKINIICMGRPPLHITPLFEYFSEDETLRSQYHLHVGQS… |
| A0A0D8XVQ7 | 210-319 | None |
| A0A1I7WUY3 | 2-109 | None |
| W2T8P7 | 367-476 | None |
| A0A821JAS8 | 114-221 | None |
| A0A0M3I3A8 | 492-602 | None |
| A0A444T137 | 122-223 | None |
| A0A812Y9J7 | 317-428 | None |
| A0A1V8UKQ6 | 290-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.