DPCstruct | MC49631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 131 ± 17 aa |
| Standard deviation of domain lengths | 16.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2LSD3 | 13-138 | YIEPKILPVCDALNAIAGVRTLWSCEGHAQRPSRPYIVFESSEAFAFQVHQLLESAMDRGALRYWWRMTANFRPSGRLQWLVEAPTI… |
| A0A4R4R9N0 | 49-179 | HPKWREAIEPGVRSLVDAATRDWRLVTYDSCQGHLYPGLDLPPSERRVGILPRDRTEYARVAAALCRAVTAVATDLPAEVQVAVGRA… |
| A0A3E0PNA2 | 13-128 | None |
| A0A497B181 | 5-111 | None |
| A0A6J4K3I1 | 18-166 | None |
| A0A2P9GYA5 | 11-113 | None |
| A0A7V2RU05 | 4-127 | None |
| A0A0F9N415 | 1-105 | None |
| A0A1F7QN29 | 19-175 | None |
| A0A1X4N416 | 72-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.