DPCstruct | MC4963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 10.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U9IDN5 | 4-87 | ECPLCHRWLPLERHHIFGGSCRRKSEQYGLVIGLCHWCHNEPPHGAHHNAQTALALHQYGQRKWMEEQGGTIDDFRREFGRNYL |
| A0A843HTR3 | 1-91 | MESILQSERKCFICGRQGELDEHHCISGNSNRKNSEAYGLKVWLCRDCHSKVHDKGEMALQLKQFAQRRWEEEYGDRHDFITVFGKS… |
| R5G0Z0 | 2-114 | None |
| A0A1H3WMF2 | 1-93 | None |
| A0A7G5N138 | 98-173 | None |
| A0A396QFM4 | 1-72 | None |
| A0A1T4Q4X8 | 4-99 | None |
| A0A1Q6K3I8 | 38-122 | None |
| A0A416ZRY4 | 40-125 | None |
| R6CVL5 | 14-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.