DPCstruct | MC49627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 84 ± 11 aa |
| Standard deviation of domain lengths | 11.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11228 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P1T3N3 | 4-81 | KNTIHQRWIKRMNRGGDDPNYADSWAWEQCGGCCFWIPLAGVFGADWGVCSNPESQFDRVAMYEHDGCTDFKEDPAGW |
| A0A094SFG2 | 76-145 | RDQASKRWYAGDSGPNALIAQSAPKPCQTCGFFLPIAGSLRASFGVCANAIAPDDARVVSVDHGCGAHSE |
| A0A6J6Z3M7 | 60-137 | None |
| A0A3C0PIX7 | 45-114 | None |
| A0A2V7YHD9 | 215-292 | None |
| A0A7Y6FRI6 | 11-117 | None |
| A0A2G6JUR8 | 142-233 | None |
| A0A1H5ECJ2 | 14-91 | None |
| A0A552QVU6 | 1-70 | None |
| A0A7K0D0P6 | 141-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.