DPCstruct | MC49625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 211 ± 33 aa |
| Standard deviation of domain lengths | 33.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380U2Y5 | 21-236 | AGFQLLVNKLEQGKDVNSHLSKLTGNAEHIDYLLDGYGIKHFHLGIFEKDNFMERTGELALAFVTQDEIFFITSKEHGDETWYGKDV… |
| A0A840BT49 | 58-306 | ARPRDVYLSGEFIGNSLRERYKQPLEYLLSAIKSGADLRKYQSRRIDQAVVVPGSVPLKRRQDIDLMLNSFGIYHLHMSDQVEDDGF… |
| A0A554RY74 | 9-204 | None |
| A0A7X3LQK8 | 42-241 | None |
| A0A4U8S2P4 | 13-210 | None |
| A0A5C8BR01 | 28-302 | None |
| A0A502J702 | 17-182 | None |
| A0A2S6J547 | 7-186 | None |
| A0A4R3MWX9 | 44-279 | None |
| A0A3N5KKC1 | 39-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.