DPCstruct | MC49620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 238 ± 22 aa |
| Standard deviation of domain lengths | 22.41 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3MHI4 | 1-204 | GGTETTCYRITVAGYPVTYETGPFCPDTITDSADAGGIWFDGNGVYDLDGEFIVGLSELYGDDNWLMYDDDGNVLVTETAEEFEAAA… |
| A0A239FRU9 | 1-212 | MKHHSRKVRLLVTAAILCTPQIAAAHPDLAEFEQTAFVEHPTTVDCTLTDGTAATCYEITVGYKPADLEIGPFCPATLNDAGGIWDW… |
| A0A2Z2NU82 | 36-288 | None |
| A0A6L6U8R2 | 2-236 | None |
| A0A520Q4K1 | 160-447 | None |
| A0A2D5RYS5 | 2-239 | None |
| A0A6J6HLH9 | 402-652 | None |
| A0A4P8EEM0 | 2-246 | None |
| A0A848V4K2 | 1-239 | None |
| A0A6J7NBS6 | 1-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.