DPCstruct | MC4962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 157 ± 16 aa |
| Standard deviation of domain lengths | 15.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6W8T2 | 668-798 | ANRVIVAAKMAEILSGCSDVIHERANTLNIKRRRVDPRNAVWLYDVSGGEDTHRVRLKAMRNKNLRTLSKADVRVSCDCNFWQWQGP… |
| A0A843HSH9 | 12-184 | LPARIIEDTRARLIGQSKSSQKGRQRYDRRVKSSVANTVKQYNSIDMNKLFKEDILTVNINVNGETNDYIVRISFGGFSDLIQDEIK… |
| A0A1G3M139 | 649-822 | None |
| A0A842TCP6 | 113-306 | None |
| A0A2E8A811 | 23-197 | None |
| A0A2E8K2C7 | 107-256 | None |
| A0A377TII2 | 97-236 | None |
| A0A2D5PHC5 | 46-214 | None |
| A0A0B6XFV0 | 87-238 | None |
| A0A0F9XWW2 | 20-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.