DPCstruct | MC49616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 233 ± 31 aa |
| Standard deviation of domain lengths | 30.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16751 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D0SYN0 | 1-216 | MRSPRDVFATGRSRRERIRPRRRARGVTEPNREESEELDLATIARDDELLDALGRGEEVPVADPVATTLAAWRTDLLDGRPPRPRQG… |
| A0A5A7SE04 | 1-226 | MARESKRRFGAGSEHVDPYADTAGDGTPVDIAAVRRDDALIDAIASDGPVATDSTDEYQVATLLANWRAEITAPPLPAAPDMDEIFA… |
| A0A5Q3QAF2 | 74-340 | None |
| A0A1C4Y084 | 8-201 | None |
| A0A2W6DMB5 | 1-198 | None |
| A0A1H0P4W4 | 2-256 | None |
| A0A4R4VFG8 | 26-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.