DPCstruct | MC49604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 227 ± 54 aa |
| Standard deviation of domain lengths | 54.16 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 23.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06834 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3R7G0 | 36-232 | HIHWYVYPVIYWLEILLDFICLEMAAVDIAYLTEFDPLWSDDAKSAILNSETLLFQNVAAYQACIADCMSCSAGLLASDYAFWCAGC… |
| A0A1M3JI79 | 9-251 | RHYVPDAVVSSYSNTGENPWVEVRAMSTPNPSAQAGGDGTTNEDHENNLAKFKNADVIGHPGVEVFNQFISSSGYFCEGAGTAFMPY… |
| A0A0F3NUL7 | 2-140 | None |
| A0A173KZS9 | 411-655 | None |
| A0A4Q2UZV0 | 181-431 | None |
| A0A3A1Y8N7 | 194-436 | None |
| A0A120G0P4 | 2-214 | None |
| A0A2D5RRF7 | 335-585 | None |
| A0A4Q4XCX1 | 193-440 | None |
| A0A4Z0BNT1 | 123-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.