DPCstruct | MC49602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 89 ± 16 aa |
| Standard deviation of domain lengths | 16.29 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 60.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8EZI1 | 123-193 | KANISINRRSFGKISGSFIIIAKRNANDPNITIIAEGAETALSLQQSGIKGNIIASAGISNLRNYSPFPGE |
| A0A2U3R1E3 | 13-91 | RSFGKISGSFITIAKRNANDPNITIIAEGAETALSLQQAGIKGNIIASAGISNLTNYSPFPGEKIIIAADNDSKNSITN |
| A0A2U3QTJ9 | 318-405 | None |
| A0A2U3QSI7 | 428-515 | None |
| A0A2U3RSC0 | 24-96 | None |
| A0A0F3QHU0 | 176-274 | None |
| C4YU34 | 362-459 | None |
| A0A0F3MA83 | 3-67 | None |
| A0A0F3M4A7 | 204-287 | None |
| A0A0F3RCV3 | 160-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.