DPCstruct | MC4960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 11.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5WAN9 | 1-70 | MIEKALNKIAEQILAFDEASLRSLRAKYQTRIGNFDTSKEWEKSVIIYFIINSVITKNAMFNQNLLAGKG |
| I4C3K6 | 1-86 | MGIEEVLLGLADRILDFDEASLAQLQEKYLKKVSEFSPTRDWERAIVVYFLINSVRVKNKIFNEKVKGSGPPEPTKPTKSLLKVVK |
| A0A1H0EQU8 | 1-88 | None |
| A0A139DTE4 | 1-83 | None |
| A0A7Y8LXL5 | 1-99 | None |
| A0A0H3A4H8 | 1-100 | None |
| A0A7J5VH45 | 16-114 | None |
| F3Z2E7 | 1-85 | None |
| A0A661KI93 | 1-67 | None |
| A0A2N2HZT6 | 28-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.