DPCstruct | MC49595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 384 |
|---|---|
| Mean domain length (aa) | 264 ± 70 aa |
| Standard deviation of domain lengths | 69.86 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.05 |
| Pfam Score | 79.77 |
| Assigned Pfam label(s) | PF04087- PF19422- PF16916- PF12972- PF10411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3Y269 | 6-261 | IIAGYVTGSMALLADGFHMATHAGALSVAAAAYAYAKRHARNPTYSFGTGKVGDLAGFASALILGLVALGIGIESVLRLFQPITVAF… |
| A0A0U5B005 | 3-191 | IATAIRFAGLSIACSLFVFCMTGFITLLTGSLTVAAVELYSLLCAAASTAVFLTLRSGDSRYTDPSKKILLAALVFVVGGGLWIAFV… |
| A0A1J9QXB7 | 26-335 | None |
| L5KEM1 | 2-250 | None |
| M2R1D6 | 179-448 | None |
| A0A1V2LJZ6 | 761-1168 | None |
| A0A7K2B1L8 | 19-221 | None |
| A0A3B9ZNS7 | 17-266 | None |
| A0A7R9KE83 | 10-283 | None |
| A0A2R4ZMT4 | 2-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.