DPCstruct | MC49591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 8.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3XXJ3 | 41-142 | ILLLQNDPCLLPEVCLLYNKGEALYGYCNLKDKCNKFHVCKSFVRGECRLQKCKRSHQLIHATSLQLLQDQGLNIPSVVNFQIISTY… |
| A0A643BWZ1 | 12-107 | QVCLLYNKGEALYGYCNLKDKCNKFHVCKSFVRGECRLPKCKRSHQLIHATSLQLLQDQGLNIPSVVNFQIIATYKHMKLHKMLQNK… |
| A0A3B4DFS0 | 134-229 | None |
| A0A4W4FRT8 | 25-119 | None |
| A0A060X4J6 | 134-235 | None |
| A0A0S7FGM9 | 9-96 | None |
| A0A3Q1BPI3 | 130-234 | None |
| A0A803XKG4 | 63-168 | None |
| A0A4W4FQ67 | 100-205 | None |
| A0A1S3FLW0 | 98-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.