DPCstruct | MC4959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 220 ± 36 aa |
| Standard deviation of domain lengths | 35.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2C1B2 | 39-261 | YDPVPRDVANRMQSEFKSKTYNELVKMNLLKSDEFILGKKEWEEINHFLQGNNKISVIRFYFIQFNQGKFGTKYTALQNYDGKLYIL… |
| A0A1G6Y6V1 | 1-276 | MEPLPSTFVTKQESSYRELWFNTYKYPILNTITLLQEGESENRKLDFGDIDVAITFFEQLITGLGGEDGVRVYFASPSSDGNVYNGK… |
| A0A0B4CV38 | 88-241 | None |
| A0A0N1E0I1 | 44-234 | None |
| A0A7Y0FTW6 | 91-280 | None |
| A0A1M4VSV7 | 47-266 | None |
| A0A4R2ZIL5 | 18-303 | None |
| A0A2D8SKN7 | 52-241 | None |
| A0A3D9CSI6 | 18-254 | None |
| A0A841N5K7 | 16-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.