DPCstruct | MC49583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 381 ± 51 aa |
| Standard deviation of domain lengths | 50.62 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7WH47 | 1-367 | MRVPIPEPGDPGIWVSRGFQLTSERIPFDAGELIRTRLSNRPWQLYRVPADQIEPINSDWRQILSAPGIHVAGKSYGTYRVAIDDSY… |
| A0A1B8AIE4 | 1-459 | MWVPLPPGIIVCEQTIDVKIESVPWTPSDLGKAPPGDDTWLGYLVPVDQLNSKPWTLIKDLPFIHIIGEIRDGSCVVAVASCIQQPF… |
| A0A132B4X7 | 1-385 | None |
| A0A420QD31 | 1-393 | None |
| A0A2V1B4P6 | 27-397 | None |
| A0A0G4KPH9 | 249-652 | None |
| A0A161Y1C4 | 112-625 | None |
| A0A0J9W024 | 1-292 | None |
| A0A420NAE4 | 3-312 | None |
| A0A3L6MTF0 | 2-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.