DPCstruct | MC4958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 90 ± 4 aa |
| Standard deviation of domain lengths | 4.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 36.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q0YZW1 | 5-95 | SQGIEEIAKKLSNLSKLAIEEYEPLVNKIIISKVKDERHIEKILDGLLDFCFDEEILYLYKKLCRYYYELNPHATVDYINYYRKQYE… |
| A0A1G5S0J7 | 5-95 | DEFLADIAEIAEGLANLGKEAYYEYMGPVERLCDNSSTVSENEIGLMLDYLLSFCGYEKVLGLYKKVCRTFYNKYPECISDYIVYYL… |
| A0A1Y0BFB5 | 1-89 | None |
| K1XVE6 | 31-119 | None |
| A0A3A5ABJ6 | 19-115 | None |
| A0A0A8WMK7 | 11-100 | None |
| A0A7C8F742 | 2-83 | None |
| A0A349JEC1 | 4-93 | None |
| A0A351RUR3 | 3-94 | None |
| A0A413W5A6 | 2-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.