DPCstruct | MC4957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 5.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L4WAQ6 | 1-64 | MIQNITKSDIMILTGYSKNQAQNILRKAKASMVSEGFVWYSNKRVSRVPIQAVEAILGYKLDME |
| A0A3G5FM71 | 1-56 | MTKIDLIQLGYSEYMAKKIITKAKKLLIKEGFDYYKNRKIGKVPTQTVEKIIGAKL |
| A0A7T9AD27 | 18-91 | None |
| A0A5M9QQP4 | 1-59 | None |
| A0A059MWZ8 | 10-79 | None |
| A0A6F9XXV9 | 1-63 | None |
| A0A0A1MM04 | 80-142 | None |
| A0A6F9Y8B8 | 32-91 | None |
| I7LS08 | 1-66 | None |
| A0A6H0UIQ4 | 4-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.