DPCstruct | MC49567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 129 ± 22 aa |
| Standard deviation of domain lengths | 22.40 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 12.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4WRA9 | 15-154 | ESCQYAVETLDWGLDYSLSLDPQHKISAGPYWEYAHLKVNGRFVEPQRLLDRAIDVIILGERHIGFAMEKPLEVTWQPRAVGGLTVS… |
| A0A0A0BXF7 | 2-130 | PTIPVETYTLGVARNGSNPYAHVTITGPVLAHGIQNRATLYFFPTYAQLGGYALNVGGLNFDGIHVIGLIPFGDFDRMYDVLRNEAP… |
| A0A1G2W9V4 | 16-156 | None |
| A0A3M1SVP1 | 2-104 | None |
| A0A259N9Y9 | 106-256 | None |
| A0A7Y4TNY0 | 39-143 | None |
| A0A853DRJ5 | 2-108 | None |
| A0A7W5S7Q6 | 1-138 | None |
| A0A1H9FS31 | 691-803 | None |
| I2GI26 | 7-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.