DPCstruct | MC49565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 189 ± 24 aa |
| Standard deviation of domain lengths | 23.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2HUP4 | 23-197 | LFSAFLNGMSVVAQFVEVLQGSSALEEIGQKIHRELEAQTGLTAPKTFTKQVHKVIVHETSLAHEDGARHFHFLYHHDTDWRGYFFD… |
| A0A4R8Q2D2 | 6-146 | PDGLARPLYGIVKYYMEKHQRKGHRFYLWHPDNIWHWRFDELLAATPLPNTFDAYSDDMDALVNVMKGARQALPEKHRSGVVFHLVI… |
| N4VTK2 | 6-147 | None |
| A0A423VHR6 | 66-248 | None |
| A0A1J9S4F3 | 7-213 | None |
| W6YKK9 | 5-230 | None |
| W9K458 | 1-156 | None |
| A0A545W243 | 78-285 | None |
| J4KQM4 | 36-222 | None |
| I8TW13 | 11-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.