DPCstruct | MC49563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 341 ± 65 aa |
| Standard deviation of domain lengths | 65.08 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7K3E6 | 1-343 | MNAEEFRQNVEDGQTPVTSHDDVLRIAFIYSYDPFNKDGVFDDVEKLHKRGWSFGHGDMKFNRTLDVFYLAQIAAAIWRYSDQVDGE… |
| A0A1E4EQ16 | 1-259 | MLPESWYQSHREFFAEARPGWTHQQLIEVAAVALREEGPGALERLRRQLQAIGPGYHETMTCCWLQLVELARAEQLSAEQTSRRLGF… |
| A0A179IK43 | 1-419 | None |
| A0A0G4HB99 | 1-294 | None |
| Q2H8I8 | 25-349 | None |
| A0A0A2V1H2 | 142-567 | None |
| A0A6A5JWD1 | 8-386 | None |
| A0A0F8UKL3 | 229-525 | None |
| G0S3N5 | 1-341 | None |
| J4VV02 | 188-590 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.