DPCstruct | MC4956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 3.84 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 27.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1JI99 | 4-74 | ITRDAIVACAANGNMEHDFIGQVVKVYENSALVQILEHHADDRMNARELLHQVVISLRQMTVMTPGRPAEE |
| A0A3G5FIW1 | 23-91 | KKGIKLGDICRAKSEMFSGWLRCEVVKLYQNAAMVKIIACRNPQDDVVQHELDDVAIVRIRDLTVLKEV |
| A0A1G6GFY3 | 12-82 | None |
| A0A0R2LLA6 | 3-71 | None |
| A0A2V2L4U9 | 13-79 | None |
| A0A2N6QW51 | 1-73 | None |
| A0A0R2FW99 | 14-86 | None |
| A0A0R2I1Y2 | 4-76 | None |
| A0A1L8WCW0 | 2-66 | None |
| A0A1Q1FVD0 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.