DPCstruct | MC49559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 118 ± 18 aa |
| Standard deviation of domain lengths | 17.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.30 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF00067- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F7RTU9 | 51-143 | TKAKLAVTGGFRSSKAMAKAVEERSCDIVGLARPLCGEPHLCKDLLSDKQEKARDVHPDLPRQIEIGACVVQLNQLGHGATPCDTST… |
| A0A4Q7JRH2 | 15-119 | TKIFITGGLRTISAIAKALHIVDAIGIARLAAQEPWIARDFLSGKVSGAIQPRGPFDNDSVLSNGMAGAQLRQVASGFMPFNSSDEK… |
| A0A517LIH8 | 290-435 | None |
| A0A5N6EQQ3 | 467-585 | None |
| A0A818AZS2 | 3-131 | None |
| C1D5A0 | 39-160 | None |
| I7K1G2 | 41-143 | None |
| A0A819RZG6 | 111-259 | None |
| A0A135THA2 | 307-427 | None |
| A0A2V1B6K2 | 17-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.