DPCstruct | MC49555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 427 |
|---|---|
| Mean domain length (aa) | 110 ± 18 aa |
| Standard deviation of domain lengths | 17.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0408 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7JI13 | 2-113 | PDPLDYTVGWICPVTTEYIAAQAFLDEKHAGPDDIPLHDHNDYTLGRVGRHNVVIAVLPLGEYGISSATGVAKDMLNSFHNVRIGLL… |
| A0A6A3WRS0 | 19-124 | HLGVKAGQVANRVVSVGSISRAKLLAQLLDDAKFDTFESPRGFTTFTGKKKGVQVSIIATGMGVPNMDFVVRETRAVVEGPMIIIRF… |
| A0A5C6SYS5 | 299-442 | None |
| A0A2X2S5D8 | 6-96 | None |
| A0A2V7Y1Q9 | 1-117 | None |
| A0A1V6RIR9 | 2-98 | None |
| A0A845WAW3 | 1-79 | None |
| A0A4Z0YPH5 | 433-543 | None |
| A0A1L9TXV8 | 289-408 | None |
| A0A2V5ISD1 | 2-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.