DPCstruct | MC49550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Standard deviation of domain lengths | 11.56 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4BR42 | 25-115 | YGGKAQYVKWGKDAGLNVSSDDDFFSHPTLRTYYKNHVKTVLNRVNTLTNITYKEDPTIFAWELMNEPRCTSDPTGDKLQDWIQEMA… |
| A0A1V4G225 | 2-72 | FGGMNQYVRWFQADGHDAFYTHPDIKEAYKNYVSYMLNRVNTYNGVKYKDDPAIMAWELANEPRVQSDRTG |
| A0A7G2EPH2 | 97-188 | None |
| A0A811R9A5 | 82-174 | None |
| A0A446XAH4 | 193-263 | None |
| A0A287WBP3 | 47-138 | None |
| A0A4S8IRL4 | 3-78 | None |
| A0A4R1K2M2 | 448-551 | None |
| A0A835RVC1 | 17-76 | None |
| A0A287S1K3 | 44-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.