DPCstruct | MC4955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 6.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6SGW5 | 1-91 | MAFLILHAGTEGIFSLINWWVGKNMLNTHIFMTNPEKPNEFEKISGDGLAPCIWELEIINHERISWIKNVLKQIPNPHFKEYLNDTI… |
| A0A1Z8L128 | 24-110 | HGLGFAILHEGEEAIWLLLHWWAHGDICCRALFRADSGTLEFEDVSKRSLMACVWELRVIDHERQAWVNAMLTHTPDAETYLKDKLP |
| A0A1Z1WSA1 | 1-78 | None |
| A0A2V9SMK1 | 72-168 | None |
| A0A1I3NRS4 | 168-254 | None |
| A0A4R4YNK3 | 1-103 | None |
| A0A660LKR3 | 43-125 | None |
| A0A1J5LHD0 | 1-94 | None |
| A0A1G8NR37 | 3-89 | None |
| A0A7W7XY59 | 50-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.