DPCstruct | MC49545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 4.73 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4FQK8 | 2-86 | KRYVQALGGSARVINLAQEANKQGDYRWSAELLKQVIAANPGDQVAKNLQANNFEQLGYQAESATWRGFYLTGAKELREGVHKFS |
| A0A1U9NHU1 | 109-202 | NPTNLFSLSPRQEAIRMAKLAGGEAELLQQAQRAVKSKDNQWAAQLADHLIALNPDASEPKLIKAEALEALAENLLTATGRNYYLTA… |
| A0A4Z0KZ53 | 436-535 | None |
| A0A2S8UAQ6 | 62-157 | None |
| A0A352S7J9 | 675-772 | None |
| A0A1V3X1B6 | 183-283 | None |
| C4JKA3 | 393-489 | None |
| A0A370I2G5 | 111-205 | None |
| A0A1B8G831 | 56-156 | None |
| A0A084G6P8 | 390-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.