DPCstruct | MC49543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 5.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08811 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7HQA2 | 95-184 | STGRNPNENYARELMELFTLGVGNYTEDDVKAAARALAGWRLPNRNETTAQTGIFDRTRAYAQAVTFLGKTGVMDAAGVVDQILAQD… |
| A0A2D5IE35 | 248-326 | VKGHANENYAREILELFSLGIGNYTENDIKEAARAFTGWRNQGLEFIDDRQKHDDGVKSVFGETGNWDGEDIVDLILQQ |
| U4V9P1 | 288-362 | None |
| A0A2V8BP00 | 15-89 | None |
| A0A7C3QI67 | 79-160 | None |
| A0A2E5V503 | 198-286 | None |
| A0A7G8E876 | 113-189 | None |
| A0A258TU40 | 899-986 | None |
| A0A532E8L6 | 169-245 | None |
| A0A2D5SBK0 | 681-765 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.