DPCstruct | MC49542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 8.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4MPM0 | 3-82 | TSLRSKIGALLVKPALKATLKDFDASRFGGAPLLGLKGLVVKTHGSSKRTEVKNSIIQCLTFTEQRINEKILESLKETKE |
| A0A3C1UA28 | 36-117 | SSLIKGVFKSSFVAKLCALILKTKLVHMKRYFDYRKYGGAILAGINRPVVKAHGSSDVEAFTNAILLLHRLVDIEVVDRMKE |
| A0A7C0Y6E7 | 14-95 | None |
| R7A4F3 | 111-192 | None |
| A0A7Z1N811 | 2-66 | None |
| A0A3A9B5D4 | 151-234 | None |
| A0A1Q7N7M4 | 108-212 | None |
| A0A7Z7GFQ3 | 62-159 | None |
| A0A139QPA0 | 1-80 | None |
| A0A5S9MAU2 | 67-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.