DPCstruct | MC49538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 157 |
|---|---|
| Mean domain length (aa) | 104 ± 21 aa |
| Standard deviation of domain lengths | 20.58 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 99.31 |
| Assigned Pfam label(s) | CL0361- PF18615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194RLD8 | 11-85 | GFICRLCSEMHRVVLHIYGHEGIRLNISEKINKYLSINVSPSDPLPKTICNNCLERLENQHRLVMRIEQAANLLK |
| B4H6I7 | 6-99 | QYSIHTVCRTCLSTLHDTMAYDLFLIPGLAKKLCVCTSLSVEQQDGFPKNLCFNCYAKLNELHDFQKLCVDSVQKFQDLVSSNAFTC… |
| B4IF79 | 61-164 | None |
| A0A6J1WRV3 | 1-75 | None |
| A0A2A4JUJ7 | 251-348 | None |
| A0A5E4QCX7 | 2-106 | None |
| A0A5E4QF13 | 3-72 | None |
| A0A6J1WHU3 | 2-117 | None |
| A0A7E5WT35 | 26-126 | None |
| A0A1B0BMM4 | 5-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.