DPCstruct | MC49535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 239 ± 60 aa |
| Standard deviation of domain lengths | 59.75 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 92.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1P0U3 | 41-251 | WAQRTGSARPIAQVIVTGTVTGTDAMSAEDALIAGLSEADRAIDSGATLIVPRAGSRDLVTARSIIGLLTKRDAAAVTHQPEGMPDA… |
| A0A663BKU9 | 2-184 | RYTRALAQEGVTLFGVGELGMANTTPAAAMVSVLTGSDAQEVVGIGANLPLAKVGNKVEVVRRAIALNQPDPKDGLDVLSKVGGFDL… |
| A0A7C0W2H5 | 2-145 | None |
| A0A5B8MBZ3 | 473-761 | None |
| A0A6M0F7R3 | 15-254 | None |
| A0A354XPN6 | 88-277 | None |
| A0A2J2H8D2 | 2-318 | None |
| H1LHV1 | 13-211 | None |
| A0A0P9CDL8 | 67-349 | None |
| A0A2T0PXJ2 | 453-720 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.