DPCstruct | MC49533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 133 ± 44 aa |
| Standard deviation of domain lengths | 43.88 |
| Length coefficient of variation | 0.33 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9YP76 | 21-151 | RGDVGASASSAAARDGAMTNEQVRDWYNAQVATIPEQNQAWLAEGLSAELRAQRAYAIRHDARIEARNKMSSEAEVEQLRARDQAKY… |
| A0A1I1B3P6 | 10-122 | YEKLIGTLSNLEVRIWYNSKDKNIVKKIDSSLPIKEQAFQAHKLRNQYRMQARKLMKDRQLADYLDSNHSNLPFEYYEKKYSKKGFA… |
| A0A7L4ZUS6 | 103-217 | None |
| A0A1X0DJS6 | 10-128 | None |
| A0A2M8D3K4 | 47-192 | None |
| Q7VJK2 | 298-423 | None |
| A0A0D4DH20 | 43-174 | None |
| A0A1G7VRN6 | 284-385 | None |
| A0A2D3JLS3 | 9-98 | None |
| A0A839IQ13 | 215-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.