DPCstruct | MC49532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02720 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9YMW7 | 1-102 | MPTKLGGQWVLSCAHWLSWRIGVGIEAAREKVRVARALELLTNVDALFGRGELSYSKVRAITRVATPETEQHFLDVAAHATAAQLER… |
| A0A7V1YLP9 | 42-138 | AELERTGRYRDEGARDTAHLVQMRYGVSGWEARRMVQAASALERLPHLARALTSGLLGPDKVLELCRFATPATERGLIAWARRVSYG… |
| A0A3C0P872 | 55-168 | None |
| A0A7Y2C9H2 | 56-152 | None |
| A0A6C0U076 | 41-138 | None |
| A0A843S8I5 | 55-151 | None |
| A0A7Y2MUY7 | 49-145 | None |
| A0A534VL81 | 95-189 | None |
| Q0RNE6 | 191-286 | None |
| A0A4Y9NLK9 | 28-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.