DPCstruct | MC4953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 11.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 52.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850S881 | 437-547 | LENDGIKWIYVAGEKHAATLNLVPGNSVYGEKLVKQDGDEYRLWDPYRSKLAGAMRKGLKGMPIKHGTKVLYLGASTGTTVSHVSDI… |
| Q2PET2 | 233-343 | SFLQEQVMVVPHRFEGFFNAKGKKNILCTRNLVPGEALYGEKLIHVQNEDGTEVEYRVCDPRRSKLGAAILGGVTNIWIKPGSRVMY… |
| A0A2I4CWL5 | 510-627 | None |
| A0A151TUT5 | 1-113 | None |
| A0A812LQ15 | 857-975 | None |
| A0A0N0NQH2 | 77-193 | None |
| A0A5E4Q9W3 | 15-123 | None |
| A0A4Y7L4T4 | 43-156 | None |
| A0A7R9L248 | 14-137 | None |
| A0A821XMT3 | 147-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.