DPCstruct | MC49529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 177 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5X5H0 | 7-187 | AVVVRTPFEDFVVKVRRSGSAINGEERRLADWAASQFRQGIELGDSGVATAARELLRRLEGGESAFSDGFGDAEGPAFGGASAGSLP… |
| A0A3M1Q730 | 32-183 | IATSAEVPPRCPNRVQLADPQAQLPAELRRREYFLTPAARELLGTLPHGGDEAQICAKLRAGELTLLENRAQQAIRHSSTPRPQRPD… |
| A0A0C1ZPU0 | 192-372 | None |
| A0A661P7I0 | 80-277 | None |
| A0A1W1X997 | 9-178 | None |
| A0A1F3P629 | 2-182 | None |
| A0A7S7SLC1 | 7-202 | None |
| A0A2S9YW77 | 8-163 | None |
| A0A1L6LET9 | 2-173 | None |
| A0A850GJZ4 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.