DPCstruct | MC49524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 145 ± 15 aa |
| Standard deviation of domain lengths | 14.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2WAY8 | 30-151 | EAIEVVGKIAFILGGAYPMISVINKLFYKVLQRIGNKVRTNAFSVTGILANLANNILVFKSFKEMDYRGKIINSSLTVSVAFVFGGQ… |
| A0A496LXA5 | 2-123 | EAFEVVGTIAVTLAGAFGLVAVFTKVANKPLSAIGKSLGMNEVGAAGLVASLANNIAMFQMMKDMDKRGKIINVAFAVSASFVIGDH… |
| W1HXE5 | 15-172 | None |
| A0A376VHF7 | 22-170 | None |
| A0A376RF69 | 170-327 | None |
| A0A625T9U5 | 563-717 | None |
| A0A0N7H8C7 | 89-243 | None |
| A0A7H4SI70 | 162-332 | None |
| R6XZI3 | 249-373 | None |
| A0A2G1CNH8 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.