DPCstruct | MC4952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 292 |
|---|---|
| Mean domain length (aa) | 195 ± 45 aa |
| Standard deviation of domain lengths | 45.43 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 20.76 |
| Pfam Score | 99.74 |
| Assigned Pfam label(s) | CL0023- PF00445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5BER3 | 1-127 | MNEYWKDYSGDDESFWEHEWNKHGTCINTIEPTCYTDYTPQEEVVDYLQKAVDLFKTLDTYKALAAANITPSSSATYTLDEIHSALS… |
| A0A2K3PNE6 | 2-179 | LAETWPASFCQTKTCISTIPSKFSIHGLWPQNNSSPQPRQCTTTKILEKELKPLKPRIANVWPSLTGNNFGLWNHEWTVHGTCSTMA… |
| A0A1X2I1W0 | 68-194 | None |
| A0A164XXV1 | 2-138 | None |
| A0A068V660 | 2-113 | None |
| A0A0D8XT59 | 2-157 | None |
| A0A446ITU5 | 4-101 | None |
| A0A166CQ01 | 89-288 | None |
| A0A446JTB0 | 30-199 | None |
| A0A2I0HYQ2 | 34-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.