DPCstruct | MC49516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838HX44 | 1-98 | MAALRPVLECVTVHGDGSVTAAFDYDNDLPTALSVAVGAQNGVWPAPADRGQPQVFEPGAASARPGPAFSVRFPSDEKVTWTLGPHT… |
| A0A6J4HQP7 | 14-112 | AMAQEKETFPVFECAAPNSDGTFTGFFGYQSGEAASVVMPVGAQNQFTTPAHDRGQPTTIAPGRHVAVFSVRFAAGDQVMWHLKTAN… |
| A0A832TPF2 | 3-83 | None |
| A0A4P5YBH2 | 140-232 | None |
| A0A2W4LNG6 | 69-173 | None |
| A0LR01 | 52-156 | None |
| A0A1W9QCQ4 | 253-350 | None |
| A0A1Q7K151 | 166-270 | None |
| A0A4P2Q4E8 | 290-384 | None |
| A0A6L3AEH5 | 205-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.