DPCstruct | MC49509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 4 aa |
| Standard deviation of domain lengths | 3.66 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.77 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0642- CL0541 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4S623 | 1-97 | MCNSVLLAGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRI… |
| V9IGX6 | 1-103 | MEHSGGLFSLCNQSESEGFSSVADLIDYSMNFSQSAVFCYSRPKYPGHPSFPVRLTKPVSRFTQVRSLQYLCRFVIRQNTRLDNIHK… |
| A0A4Z2DKG9 | 823-914 | None |
| A0A3S3RYL4 | 114-206 | None |
| A0A183S7J8 | 52-143 | None |
| A0A3P9P8D2 | 376-469 | None |
| A0A6P6YC41 | 516-606 | None |
| A0A6A0H532 | 600-689 | None |
| A0A7J7AGV8 | 995-1085 | None |
| A0A1P6C0A0 | 1501-1595 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.