DPCstruct | MC49508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 110 ± 14 aa |
| Standard deviation of domain lengths | 14.25 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4S3T1 | 1-101 | MLERMLYQKYQQELMEEIHPPLSPMETLSTTHRDYQAGGFQPTPPTTTQPHNYHMEQPRSFWLERAHSMPGVTCICTGDSPFRRNTA… |
| A0A4W3J8S9 | 211-304 | IEKCVSQNISKDVFKEFNSGPAMEPMEQSSVTGRDFRIKGFTSTPPQPTKKHNYKTEQPITFWSDHAKKIQGVTEIKIDNSPFKKHS… |
| A0A673XSX9 | 79-189 | None |
| A0A7J7W4P8 | 1-132 | None |
| A0A674JGU4 | 146-252 | None |
| A0A6A5DGU4 | 2-95 | None |
| A0A2U9CEC9 | 35-131 | None |
| A0A669QB32 | 266-379 | None |
| A0A1S3GVI6 | 170-301 | None |
| A0A3S1C9A6 | 110-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.