DPCstruct | MC49506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 260 ± 28 aa |
| Standard deviation of domain lengths | 27.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11228 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6JUR8 | 2-263 | DAVCERAQDVARQAAEEIAQPGAVGGHVGTEPMGERLVTHRFACTRRAYRGWQWAVTVARAPRAKNVTVCEVELLAGPESLIAPEHV… |
| A0A7K1ARZ5 | 8-220 | SVARDAALADAEFATQVGDFVSVDYDDENRVATYLFAADIAGYRGWRWCITVAKVDEDATPTVCDVVILPGPDSLLAPDHIPYMDRI… |
| A0A401NAU8 | 2-217 | None |
| A0A261F0J6 | 266-548 | None |
| A0A543F516 | 18-265 | None |
| A0A4R7V040 | 8-298 | None |
| A0A7K0D0P6 | 2-258 | None |
| A0A7X9RNA6 | 18-320 | None |
| A0A358SPW2 | 96-362 | None |
| A0A0T1Q2D4 | 2-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.